SCOP 1.67: Domain d1j5pa4: 1j5p A:-1-108,A:220-241

Lineage for d1j5pa4 (1j5p A:-1-108,A:220-241)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (14 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Hypothetical protein TM1643 [75108] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [75109] (2 PDB entries)

8. Domain d1j5pa4: 1j5p A:-1-108,A:220-241 [83092]
   Other proteins in same PDB: d1j5pa3
   complexed with nad

Details for d1j5pa4

PDB Entry: 1j5p, 1.9 Å

PDB Description: crystal structure of aspartate dehydrogenase (tm1643) from thermotoga maritima at 1.9 a resolution

SCOP Domain Sequences for d1j5pa4:

Sequence; same for both SEQRES and ATOM records:

>d1j5pa4 c.2.1.3 (A:-1-108,A:220-241) Hypothetical protein TM1643 {Thermotoga maritima}
hhmtvliigmgnigkklvelgnfekiyaydriskdipgvvrldefqvpsdvstvvecasp
eavkeyslqilknpvnyiiistsafadevfrerffselknsparvffpsgXsmltvysil
rtlrnleskiifg

Timeline for d1j5pa4:

• d1j5pa4 first appeared in SCOP 1.65
  
• d1j5pa4 appears in SCOP 1.69
  
• d1j5pa4 appears in the current release, SCOPe 2.08