| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) ![]() |
| Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
| Protein Sigma70 (SigA, RpoD) [88666] (4 species) |
| Species Thermus thermophilus [TaxId:274] [88667] (10 PDB entries) Uniprot Q9WX78 |
| Domain d1iw7p2: 1iw7 P:319-423 [83090] Other proteins in same PDB: d1iw7a1, d1iw7a2, d1iw7b1, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7f1, d1iw7f3, d1iw7k1, d1iw7k2, d1iw7l1, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7o_, d1iw7p1, d1iw7p3 complexed with mg, pb |
PDB Entry: 1iw7 (more details), 2.6 Å
SCOPe Domain Sequences for d1iw7p2:
Sequence, based on SEQRES records: (download)
>d1iw7p2 a.4.13.2 (P:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld
>d1iw7p2 a.4.13.2 (P:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
eevgaffgvtrerirqienkalrklkyhesrtrklrdfld
Timeline for d1iw7p2: