Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.17: Cystatin-like [54402] (6 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.6: Archaeosine tRNA-guanine transglycosylase, C2 domain [88802] (1 family) |
Family d.17.6.1: Archaeosine tRNA-guanine transglycosylase, C2 domain [88803] (1 protein) |
Protein Archaeosine tRNA-guanine transglycosylase, C2 domain [88804] (1 species) the second of the 3 additional C-terminal domains to the TGT-like domain, also includes "linker" C1 domain |
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [88805] (4 PDB entries) |
Domain d1it8a4: 1it8 A:361-505 [83083] Other proteins in same PDB: d1it8a1, d1it8a3, d1it8b1, d1it8b3 |
PDB Entry: 1it8 (more details), 2.5 Å
SCOP Domain Sequences for d1it8a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1it8a4 d.17.6.1 (A:361-505) Archaeosine tRNA-guanine transglycosylase, C2 domain {Archaeon Pyrococcus horikoshii} pitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylsltypfaqs eaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrla tvraddglltlgiegakrlhrvlpy
Timeline for d1it8a4: