SCOPe 2.08: Domain d1it8a4: 1it8 A:361-505

Lineage for d1it8a4 (1it8 A:361-505)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.6: Pre-PUA domain [88802] (5 families)
   this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins

5. Family d.17.6.1: Archaeosine tRNA-guanine transglycosylase, C2 domain [88803] (1 protein)

6. Protein Archaeosine tRNA-guanine transglycosylase, C2 domain [88804] (1 species)
   the second of the 3 additional C-terminal domains to the TGT-like domain, also includes "linker" C1 domain

7. Species Pyrococcus horikoshii [TaxId:53953] [88805] (4 PDB entries)

8. Domain d1it8a4: 1it8 A:361-505 [83083]
   Other proteins in same PDB: d1it8a1, d1it8a3, d1it8b1, d1it8b3
   protein/RNA complex; complexed with mg, pq0, zn

Details for d1it8a4

PDB Entry: 1it8, 2.5 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase from pyrococcus horikoshii complexed with archaeosine precursor, preq0

PDB Compounds: (A:) archaeosine tRNA-guanine transglycosylase

SCOPe Domain Sequences for d1it8a4:

Sequence; same for both SEQRES and ATOM records:

>d1it8a4 d.17.6.1 (A:361-505) Archaeosine tRNA-guanine transglycosylase, C2 domain {Pyrococcus horikoshii [TaxId: 53953]}
pitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylsltypfaqs
eaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrla
tvraddglltlgiegakrlhrvlpy

Timeline for d1it8a4:

• d1it8a4 first appeared in SCOP 1.65
  
• d1it8a4 appears in SCOPe 2.07