SCOPe 2.06: Domain d1it8a3: 1it8 A:506-582

Lineage for d1it8a3 (1it8 A:506-582)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.1: PUA domain [88698] (6 proteins)
   RNA-binding domain

6. Protein Archaeosine tRNA-guanine transglycosylase, C3 domain [88701] (1 species)
   the last of the 3 additional C-terminal domains to the TGT-like domain

7. Species Pyrococcus horikoshii [TaxId:53953] [88702] (4 PDB entries)

8. Domain d1it8a3: 1it8 A:506-582 [83082]
   Other proteins in same PDB: d1it8a1, d1it8a4, d1it8b1, d1it8b4
   protein/RNA complex; complexed with mg, pq0, zn

Details for d1it8a3

PDB Entry: 1it8, 2.5 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase from pyrococcus horikoshii complexed with archaeosine precursor, preq0

PDB Compounds: (A:) archaeosine tRNA-guanine transglycosylase

SCOPe Domain Sequences for d1it8a3:

Sequence; same for both SEQRES and ATOM records:

>d1it8a3 b.122.1.1 (A:506-582) Archaeosine tRNA-guanine transglycosylase, C3 domain {Pyrococcus horikoshii [TaxId: 53953]}
prmrvvvnkeaepfarkgkdvfakfvifadpgirpydevlvvnendellatgqallsgre
mivfqygravkvrkgve

Timeline for d1it8a3:

• d1it8a3 first appeared in SCOP 1.65
  
• d1it8a3 appears in SCOPe 2.05
  
• d1it8a3 appears in SCOPe 2.07
  
• d1it8a3 appears in the current release, SCOPe 2.08