Lineage for d1it7b4 (1it7 B:361-505)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2544506Superfamily d.17.6: Pre-PUA domain [88802] (5 families) (S)
    this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins
  5. 2544507Family d.17.6.1: Archaeosine tRNA-guanine transglycosylase, C2 domain [88803] (1 protein)
  6. 2544508Protein Archaeosine tRNA-guanine transglycosylase, C2 domain [88804] (1 species)
    the second of the 3 additional C-terminal domains to the TGT-like domain, also includes "linker" C1 domain
  7. 2544509Species Pyrococcus horikoshii [TaxId:53953] [88805] (4 PDB entries)
  8. 2544513Domain d1it7b4: 1it7 B:361-505 [83081]
    Other proteins in same PDB: d1it7a1, d1it7a3, d1it7b1, d1it7b3
    protein/RNA complex; complexed with gun, mg, zn

Details for d1it7b4

PDB Entry: 1it7 (more details), 2.3 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase complexed with guanine
PDB Compounds: (B:) archaeosine tRNA-guanine transglycosylase

SCOPe Domain Sequences for d1it7b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it7b4 d.17.6.1 (B:361-505) Archaeosine tRNA-guanine transglycosylase, C2 domain {Pyrococcus horikoshii [TaxId: 53953]}
pitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylsltypfaqs
eaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrla
tvraddglltlgiegakrlhrvlpy

SCOPe Domain Coordinates for d1it7b4:

Click to download the PDB-style file with coordinates for d1it7b4.
(The format of our PDB-style files is described here.)

Timeline for d1it7b4: