Lineage for d1it7a4 (1it7 A:361-505)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326290Fold d.17: Cystatin-like [54402] (6 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 326661Superfamily d.17.6: Archaeosine tRNA-guanine transglycosylase, C2 domain [88802] (1 family) (S)
  5. 326662Family d.17.6.1: Archaeosine tRNA-guanine transglycosylase, C2 domain [88803] (1 protein)
  6. 326663Protein Archaeosine tRNA-guanine transglycosylase, C2 domain [88804] (1 species)
    the second of the 3 additional C-terminal domains to the TGT-like domain, also includes "linker" C1 domain
  7. 326664Species Archaeon Pyrococcus horikoshii [TaxId:53953] [88805] (4 PDB entries)
  8. 326667Domain d1it7a4: 1it7 A:361-505 [83079]
    Other proteins in same PDB: d1it7a1, d1it7a3, d1it7b1, d1it7b3

Details for d1it7a4

PDB Entry: 1it7 (more details), 2.3 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase complexed with guanine

SCOP Domain Sequences for d1it7a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it7a4 d.17.6.1 (A:361-505) Archaeosine tRNA-guanine transglycosylase, C2 domain {Archaeon Pyrococcus horikoshii}
pitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylsltypfaqs
eaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrla
tvraddglltlgiegakrlhrvlpy

SCOP Domain Coordinates for d1it7a4:

Click to download the PDB-style file with coordinates for d1it7a4.
(The format of our PDB-style files is described here.)

Timeline for d1it7a4: