Lineage for d1it7a3 (1it7 A:506-582)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383312Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 383313Superfamily b.122.1: PUA domain-like [88697] (3 families) (S)
  5. 383314Family b.122.1.1: PUA domain [88698] (3 proteins)
    RNA-binding domain
  6. 383315Protein Archaeosine tRNA-guanine transglycosylase, C3 domain [88701] (1 species)
    the last of the 3 additional C-terminal domains to the TGT-like domain
  7. 383316Species Archaeon Pyrococcus horikoshii [TaxId:53953] [88702] (4 PDB entries)
  8. 383319Domain d1it7a3: 1it7 A:506-582 [83078]
    Other proteins in same PDB: d1it7a1, d1it7a4, d1it7b1, d1it7b4

Details for d1it7a3

PDB Entry: 1it7 (more details), 2.3 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase complexed with guanine

SCOP Domain Sequences for d1it7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it7a3 b.122.1.1 (A:506-582) Archaeosine tRNA-guanine transglycosylase, C3 domain {Archaeon Pyrococcus horikoshii}
prmrvvvnkeaepfarkgkdvfakfvifadpgirpydevlvvnendellatgqallsgre
mivfqygravkvrkgve

SCOP Domain Coordinates for d1it7a3:

Click to download the PDB-style file with coordinates for d1it7a3.
(The format of our PDB-style files is described here.)

Timeline for d1it7a3: