Class b: All beta proteins [48724] (126 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (3 families) |
Family b.122.1.1: PUA domain [88698] (2 proteins) RNA-binding domain |
Protein Archaeosine tRNA-guanine transglycosylase, C3 domain [88701] (1 species) the last of the 3 additional C-terminal domains to the TGT-like domain |
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [88702] (4 PDB entries) |
Domain d1it7a3: 1it7 A:506-582 [83078] Other proteins in same PDB: d1it7a1, d1it7a4, d1it7b1, d1it7b4 |
PDB Entry: 1it7 (more details), 2.3 Å
SCOP Domain Sequences for d1it7a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1it7a3 b.122.1.1 (A:506-582) Archaeosine tRNA-guanine transglycosylase, C3 domain {Archaeon Pyrococcus horikoshii} prmrvvvnkeaepfarkgkdvfakfvifadpgirpydevlvvnendellatgqallsgre mivfqygravkvrkgve
Timeline for d1it7a3: