SCOPe 2.08: Domain d1it7a3: 1it7 A:506-582

Lineage for d1it7a3 (1it7 A:506-582)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.1: PUA domain [88698] (6 proteins)
   RNA-binding domain

6. Protein Archaeosine tRNA-guanine transglycosylase, C3 domain [88701] (1 species)
   the last of the 3 additional C-terminal domains to the TGT-like domain

7. Species Pyrococcus horikoshii [TaxId:53953] [88702] (4 PDB entries)

8. Domain d1it7a3: 1it7 A:506-582 [83078]
   Other proteins in same PDB: d1it7a1, d1it7a4, d1it7b1, d1it7b4
   protein/RNA complex; complexed with gun, mg, zn

Details for d1it7a3

PDB Entry: 1it7, 2.3 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase complexed with guanine

PDB Compounds: (A:) archaeosine tRNA-guanine transglycosylase

SCOPe Domain Sequences for d1it7a3:

Sequence; same for both SEQRES and ATOM records:

>d1it7a3 b.122.1.1 (A:506-582) Archaeosine tRNA-guanine transglycosylase, C3 domain {Pyrococcus horikoshii [TaxId: 53953]}
prmrvvvnkeaepfarkgkdvfakfvifadpgirpydevlvvnendellatgqallsgre
mivfqygravkvrkgve

Timeline for d1it7a3:

• d1it7a3 first appeared in SCOP 1.65
  
• d1it7a3 appears in SCOPe 2.07