SCOP 1.75: Domain d1iq8b4: 1iq8 B:361-505

Lineage for d1iq8b4 (1iq8 B:361-505)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.6: Pre-PUA domain [88802] (5 families)
   this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins

5. Family d.17.6.1: Archaeosine tRNA-guanine transglycosylase, C2 domain [88803] (1 protein)

6. Protein Archaeosine tRNA-guanine transglycosylase, C2 domain [88804] (1 species)
   the second of the 3 additional C-terminal domains to the TGT-like domain, also includes "linker" C1 domain

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [88805] (4 PDB entries)

8. Domain d1iq8b4: 1iq8 B:361-505 [83077]
   Other proteins in same PDB: d1iq8a1, d1iq8a3, d1iq8b1, d1iq8b3
   complexed with mg, zn

Details for d1iq8b4

PDB Entry: 1iq8, 2.2 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase from pyrococcus horikoshii

PDB Compounds: (B:) archaeosine tRNA-guanine transglycosylase

SCOP Domain Sequences for d1iq8b4:

Sequence; same for both SEQRES and ATOM records:

>d1iq8b4 d.17.6.1 (B:361-505) Archaeosine tRNA-guanine transglycosylase, C2 domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
pitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylsltypfaqs
eaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrla
tvraddglltlgiegakrlhrvlpy

Timeline for d1iq8b4:

• d1iq8b4 first appeared in SCOP 1.65
  
• d1iq8b4 appears in SCOP 1.73
  
• d1iq8b4 appears in SCOPe 2.01
  
• d1iq8b4 appears in the current release, SCOPe 2.08