Lineage for d1iq8b4 (1iq8 B:361-505)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 719267Superfamily d.17.6: Pre-PUA domain [88802] (4 families) (S)
    this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins
  5. 719268Family d.17.6.1: Archaeosine tRNA-guanine transglycosylase, C2 domain [88803] (1 protein)
  6. 719269Protein Archaeosine tRNA-guanine transglycosylase, C2 domain [88804] (1 species)
    the second of the 3 additional C-terminal domains to the TGT-like domain, also includes "linker" C1 domain
  7. 719270Species Archaeon Pyrococcus horikoshii [TaxId:53953] [88805] (4 PDB entries)
  8. 719272Domain d1iq8b4: 1iq8 B:361-505 [83077]
    Other proteins in same PDB: d1iq8a1, d1iq8a3, d1iq8b1, d1iq8b3
    complexed with mg, zn

Details for d1iq8b4

PDB Entry: 1iq8 (more details), 2.2 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase from pyrococcus horikoshii
PDB Compounds: (B:) archaeosine tRNA-guanine transglycosylase

SCOP Domain Sequences for d1iq8b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iq8b4 d.17.6.1 (B:361-505) Archaeosine tRNA-guanine transglycosylase, C2 domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
pitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylsltypfaqs
eaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrla
tvraddglltlgiegakrlhrvlpy

SCOP Domain Coordinates for d1iq8b4:

Click to download the PDB-style file with coordinates for d1iq8b4.
(The format of our PDB-style files is described here.)

Timeline for d1iq8b4: