Lineage for d1iq8b3 (1iq8 B:506-582)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472865Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 472866Superfamily b.122.1: PUA domain-like [88697] (4 families) (S)
  5. 472867Family b.122.1.1: PUA domain [88698] (4 proteins)
    RNA-binding domain
  6. 472868Protein Archaeosine tRNA-guanine transglycosylase, C3 domain [88701] (1 species)
    the last of the 3 additional C-terminal domains to the TGT-like domain
  7. 472869Species Archaeon Pyrococcus horikoshii [TaxId:53953] [88702] (4 PDB entries)
  8. 472871Domain d1iq8b3: 1iq8 B:506-582 [83076]
    Other proteins in same PDB: d1iq8a1, d1iq8a4, d1iq8b1, d1iq8b4

Details for d1iq8b3

PDB Entry: 1iq8 (more details), 2.2 Å

PDB Description: crystal structure of archaeosine trna-guanine transglycosylase from pyrococcus horikoshii

SCOP Domain Sequences for d1iq8b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iq8b3 b.122.1.1 (B:506-582) Archaeosine tRNA-guanine transglycosylase, C3 domain {Archaeon Pyrococcus horikoshii}
prmrvvvnkeaepfarkgkdvfakfvifadpgirpydevlvvnendellatgqallsgre
mivfqygravkvrkgve

SCOP Domain Coordinates for d1iq8b3:

Click to download the PDB-style file with coordinates for d1iq8b3.
(The format of our PDB-style files is described here.)

Timeline for d1iq8b3: