SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1hxka3 (1hxk A:31-411)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097504Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2097583Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2097584Family c.6.2.1: alpha-mannosidase [88714] (2 protein domains)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 2097585Protein Golgi alpha-mannosidase II [88715] (1 species)
  7. 2097586Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. 2097622Domain d1hxka3: 1hxk A:31-411 [83072]
    Other proteins in same PDB: d1hxka1, d1hxka2
    complexed with dmj, mrd, nag, zn

Details for d1hxka3

PDB Entry: 1hxk (more details), 1.5 Å

PDB Description: golgi alpha-mannosidase ii in complex with deoxymannojirimicin
PDB Compounds: (A:) Alpha-mannosidase II

SCOPe Domain Sequences for d1hxka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxka3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
ragqaefptlsgdfftyadrs

SCOPe Domain Coordinates for d1hxka3:

Click to download the PDB-style file with coordinates for d1hxka3.
(The format of our PDB-style files is described here.)

Timeline for d1hxka3: