![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains |
![]() | Protein Golgi alpha-mannosidase II [88657] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (23 PDB entries) |
![]() | Domain d1hxka2: 1hxk A:523-1044 [83071] Other proteins in same PDB: d1hxka1, d1hxka3 complexed with ddm, mpd, nag, zn |
PDB Entry: 1hxk (more details), 1.5 Å
SCOP Domain Sequences for d1hxka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxka2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs
Timeline for d1hxka2: