Lineage for d1hxka2 (1hxk A:523-1044)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 460730Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 460800Superfamily b.30.5: Galactose mutarotase-like [74650] (10 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 461052Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 461053Protein Golgi alpha-mannosidase II [88657] (1 species)
  7. 461054Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (7 PDB entries)
  8. 461058Domain d1hxka2: 1hxk A:523-1044 [83071]
    Other proteins in same PDB: d1hxka1, d1hxka3

Details for d1hxka2

PDB Entry: 1hxk (more details), 1.5 Å

PDB Description: golgi alpha-mannosidase ii in complex with deoxymannojirimicin

SCOP Domain Sequences for d1hxka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxka2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster)}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

SCOP Domain Coordinates for d1hxka2:

Click to download the PDB-style file with coordinates for d1hxka2.
(The format of our PDB-style files is described here.)

Timeline for d1hxka2: