Lineage for d1hwwa2 (1hww A:523-1044)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1534928Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1535067Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1535396Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 1535397Protein Golgi alpha-mannosidase II [88657] (1 species)
  7. 1535398Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. 1535451Domain d1hwwa2: 1hww A:523-1044 [83068]
    Other proteins in same PDB: d1hwwa1, d1hwwa3
    complexed with mrd, nag, swa, zn

Details for d1hwwa2

PDB Entry: 1hww (more details), 1.87 Å

PDB Description: golgi alpha-mannosidase ii in complex with swainsonine
PDB Compounds: (A:) Alpha-mannosidase II

SCOPe Domain Sequences for d1hwwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwwa2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

SCOPe Domain Coordinates for d1hwwa2:

Click to download the PDB-style file with coordinates for d1hwwa2.
(The format of our PDB-style files is described here.)

Timeline for d1hwwa2: