Class b: All beta proteins [48724] (149 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains |
Protein Golgi alpha-mannosidase II [88657] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (9 PDB entries) |
Domain d1hwwa2: 1hww A:523-1044 [83068] Other proteins in same PDB: d1hwwa1, d1hwwa3 complexed with mpd, nag, swa, zn |
PDB Entry: 1hww (more details), 1.87 Å
SCOP Domain Sequences for d1hwwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwwa2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster)} yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs
Timeline for d1hwwa2: