SCOP 1.71: Domain d1hwwa1: 1hww A:412-522

Lineage for d1hwwa1 (1hww A:412-522)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (8 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (3 families)

5. Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family

6. Protein Golgi alpha-mannosidase II [88694] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (9 PDB entries)

8. Domain d1hwwa1: 1hww A:412-522 [83067]
   Other proteins in same PDB: d1hwwa2, d1hwwa3
   complexed with mpd, nag, swa, zn

Details for d1hwwa1

PDB Entry: 1hww, 1.87 Å

PDB Description: golgi alpha-mannosidase ii in complex with swainsonine

SCOP Domain Sequences for d1hwwa1:

Sequence; same for both SEQRES and ATOM records:

>d1hwwa1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster)}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs

Timeline for d1hwwa1:

• d1hwwa1 first appeared in SCOP 1.65
  
• d1hwwa1 appears in SCOP 1.69
  
• d1hwwa1 appears in SCOP 1.73
  
• d1hwwa1 appears in the current release, SCOPe 2.08