Lineage for d1h6wa1 (1h6w A:246-327)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2074990Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
    (homo)trimer; each chain donates 3 beta-strands per turn of the helix
  4. 2074991Superfamily b.108.1: Phage fibre proteins [69349] (6 families) (S)
  5. 2074992Family b.108.1.1: Middle part of short tail fibre protein gp12 [69350] (1 protein)
    automatically mapped to Pfam PF09089
  6. 2074993Protein Middle part of short tail fibre protein gp12 [88691] (1 species)
    includes the N-terminal cap (sub)domain
  7. 2074994Species Bacteriophage T4 [TaxId:10665] [88692] (1 PDB entry)
  8. 2074995Domain d1h6wa1: 1h6w A:246-327 [83060]
    Other proteins in same PDB: d1h6w.2

Details for d1h6wa1

PDB Entry: 1h6w (more details), 1.9 Å

PDB Description: crystal structure of a heat- and protease-stable fragment of the bacteriophage t4 short fibre
PDB Compounds: (A:) bacteriophage t4 short tail fibre

SCOPe Domain Sequences for d1h6wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6wa1 b.108.1.1 (A:246-327) Middle part of short tail fibre protein gp12 {Bacteriophage T4 [TaxId: 10665]}
tgatlngrgsttsmrgvvkltttagsqsggdassalawnadvihqrggqtingtlrinnt
ltiasgganitgtvnmtggyiq

SCOPe Domain Coordinates for d1h6wa1:

Click to download the PDB-style file with coordinates for d1h6wa1.
(The format of our PDB-style files is described here.)

Timeline for d1h6wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h6w.2
View in 3D
Domains from other chains:
(mouse over for more information)
d1h6w.2