Lineage for d1go3m2 (1go3 M:1-78)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 338458Fold d.230: Dodecin subunit-like [88797] (3 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 338459Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP4 (RpoE) [88798] (1 family) (S)
  5. 338460Family d.230.1.1: N-terminal, heterodimerisation domain of RBP4 (RpoE) [88799] (1 protein)
  6. 338461Protein N-terminal, heterodimerisation domain of RBP4 (RpoE) [88800] (1 species)
  7. 338462Species Archaeon Methanococcus jannaschii [TaxId:2190] [88801] (1 PDB entry)
  8. 338464Domain d1go3m2: 1go3 M:1-78 [83057]
    Other proteins in same PDB: d1go3e1, d1go3f_, d1go3m1, d1go3n_

Details for d1go3m2

PDB Entry: 1go3 (more details), 1.75 Å

PDB Description: structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex

SCOP Domain Sequences for d1go3m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1go3m2 d.230.1.1 (M:1-78) N-terminal, heterodimerisation domain of RBP4 (RpoE) {Archaeon Methanococcus jannaschii}
mykileiadvvkvppeefgkdlketvkkilmekyegrldkdvgfvlsivdvkdigegkvv
hgdgsayhpvvfetlvyi

SCOP Domain Coordinates for d1go3m2:

Click to download the PDB-style file with coordinates for d1go3m2.
(The format of our PDB-style files is described here.)

Timeline for d1go3m2: