Lineage for d1go3e2 (1go3 E:1-78)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740555Fold d.230: Dodecin subunit-like [88797] (5 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 740556Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (1 family) (S)
  5. 740557Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein)
  6. 740558Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (3 species)
  7. 740559Species Archaeon Methanococcus jannaschii [TaxId:2190] [88801] (1 PDB entry)
  8. 740560Domain d1go3e2: 1go3 E:1-78 [83055]
    Other proteins in same PDB: d1go3e1, d1go3f_, d1go3m1, d1go3n_

Details for d1go3e2

PDB Entry: 1go3 (more details), 1.75 Å

PDB Description: structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
PDB Compounds: (E:) DNA-directed RNA polymerase subunit e

SCOP Domain Sequences for d1go3e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1go3e2 d.230.1.1 (E:1-78) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]}
mykileiadvvkvppeefgkdlketvkkilmekyegrldkdvgfvlsivdvkdigegkvv
hgdgsayhpvvfetlvyi

SCOP Domain Coordinates for d1go3e2:

Click to download the PDB-style file with coordinates for d1go3e2.
(The format of our PDB-style files is described here.)

Timeline for d1go3e2: