Lineage for d1fod.1 (1fod 4:,2:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431063Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2431064Protein Aphthovirus (Foot-and-mouth disease virus) coat proteins [49659] (1 species)
  7. 2431065Species FMDV (Foot-and-mouth disease virus), strain bfs, 1860 [TaxId:12110] [49660] (4 PDB entries)
  8. 2431072Domain d1fod.1: 1fod 4:,2: [83052]

Details for d1fod.1

PDB Entry: 1fod (more details), 2.6 Å

PDB Description: structure of a major immunogenic site on foot-and-mouth disease virus
PDB Compounds: (2:) foot and mouth disease virus, (4:) foot and mouth disease virus

SCOPe Domain Sequences for d1fod.1:

Sequence, based on SEQRES records: (download)

>g1fod.1 b.121.4.1 (4:,2:) Aphthovirus (Foot-and-mouth disease virus) coat proteins {FMDV (Foot-and-mouth disease virus), strain bfs, 1860 [TaxId: 12110]}
sgntgsiinnyymqqyqnsmdtqlgdnaisggsnegstdttsthttntqnndwfsklass
afsglfgallaXeettlledrilttrnghttsttqssvgvtygyataedfvsgpntsgle
trvvqaerffkthlfdwvtsdsfgrchllelptdhkgvygsltdsyaymrngwdvevtav
gnqfnggcllvamvpelcsiqkrelyqltlfphqfinprtnmtahitvpfvgvnrydqyk
vhkpwtlvvmvvapltvntegapqikvyaniaptnvhvagefpske

Sequence, based on observed residues (ATOM records): (download)

>g1fod.1 b.121.4.1 (4:,2:) Aphthovirus (Foot-and-mouth disease virus) coat proteins {FMDV (Foot-and-mouth disease virus), strain bfs, 1860 [TaxId: 12110]}
sgntgsiinnyymqqyqnsmdtqlgdndwfsklassafsglfgallaXeettlledrilt
trnghttsttqssvgvtygyataedfvsgpntsgletrvvqaerffkthlfdwvtsdsfg
rchllelptdhkgvygsltdsyaymrngwdvevtavgnqfnggcllvamvpelcsiqkre
lyqltlfphqfinprtnmtahitvpfvgvnrydqykvhkpwtlvvmvvapltvntegapq
ikvyaniaptnvhvagefpske

SCOPe Domain Coordinates for d1fod.1:

Click to download the PDB-style file with coordinates for d1fod.1.
(The format of our PDB-style files is described here.)

Timeline for d1fod.1: