SCOP 1.65: Domain d1es6a2: 1es6 A:201-321

Lineage for d1es6a2 (1es6 A:201-321)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.31: EV matrix protein [50011] (1 superfamily)
   consists of two beta-sandwich domains of similar topologies

4. Superfamily b.31.1: EV matrix protein [50012] (1 family)

5. Family b.31.1.1: EV matrix protein [50013] (1 protein)

6. Protein EV matrix protein [50014] (1 species)

7. Species Ebola virus [TaxId:205488] [50015] (3 PDB entries)

8. Domain d1es6a2: 1es6 A:201-321 [83049]
   mutant

Details for d1es6a2

PDB Entry: 1es6, 2 Å

PDB Description: crystal structure of the matrix protein of ebola virus

SCOP Domain Sequences for d1es6a2:

Sequence, based on SEQRES records:

>d1es6a2 b.31.1.1 (A:201-321) EV matrix protein {Ebola virus}
galrpgisfhpklrpillpnksgkkgnsadltspekiqaimtslqdfkivpidptknimg
ievpetlvlkltgkkvtskngqpiipvllpkyigldpvapgdltmvitqdcdtchspasl
p

Sequence, based on observed residues (ATOM records):

>d1es6a2 b.31.1.1 (A:201-321) EV matrix protein {Ebola virus}
galrpgisfhpklrpillpnknsadltspekiqaimtslqdfkivpidptknimgievpe
tlvlkltggqpiipvllpkyigldpvapgdltmvitqdcdtchspaslp

Timeline for d1es6a2:

• d1es6a2 is new in SCOP 1.65
  
• d1es6a2 appears in SCOP 1.67
  
• d1es6a2 appears in the current release, SCOPe 2.08