Lineage for d1cov.1 (1cov 4:,2:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304390Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 304471Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (7 families) (S)
  5. 304472Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 protein domains)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 304492Protein Human enterovirus B coat proteins [88635] (4 species)
  7. 304497Species Human coxsackievirus B3 [TaxId:12072] [49681] (1 PDB entry)
  8. 304498Domain d1cov.1: 1cov 4:,2: [83045]

Details for d1cov.1

PDB Entry: 1cov (more details), 3.5 Å

PDB Description: coxsackievirus b3 coat protein

SCOP Domain Sequences for d1cov.1:

Sequence, based on SEQRES records: (download)

>g1cov.1 b.121.4.1 (4:,2:) Human enterovirus B coat proteins {Human coxsackievirus B3}
xgaqvstqktgahetglnasiihytninyykdaasnsanrqdftqdpskftepvkdimik
slpalnXgysdrvrsitlgnstittqecanvvvgygvwpdylkdseataedqptqpdvat
crfytldsvqwqktspgwwwklpdalsnlglfgqnmqyhylgrtgytihvqcnaskfhqg
cllvvcvpeaemgcatlnntpssaellggdtakefadkpvasgsnklvqrvvynagmgvg
vgnltifphqwinlrtnnsativmpytnsvpmdnmfrhnnvtlmvipfvpldycpgstty
vpitvtiapmcaeynglrlaghq

Sequence, based on observed residues (ATOM records): (download)

>g1cov.1 b.121.4.1 (4:,2:) Human enterovirus B coat proteins {Human coxsackievirus B3}
xgaqvstqktgihytninyykdaasnsanrqdftqdpskftepvkdimikslpalnXgys
drvrsitlgnstittqecanvvvgygvwpdylkdseataedqptqpdvatcrfytldsvq
wqktspgwwwklpdalsnlglfgqnmqyhylgrtgytihvqcnaskfhqgcllvvcvpea
emgcatlnntpssaellggdtakefadkpvasgsnklvqrvvynagmgvgvgnltifphq
winlrtnnsativmpytnsvpmdnmfrhnnvtlmvipfvpldycpgsttyvpitvtiapm
caeynglrlaghq

SCOP Domain Coordinates for d1cov.1:

Click to download the PDB-style file with coordinates for d1cov.1.
(The format of our PDB-style files is described here.)

Timeline for d1cov.1: