SCOPe 2.05: Domain d1c8m.1: 1c8m 4:,2:

Lineage for d1c8m.1 (1c8m 4:,2:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Rhinovirus coat proteins [49670] (5 species)

7. Species Human rhinovirus 16, (HRV-16) [TaxId:31708] [49672] (9 PDB entries)

8. Domain d1c8m.1: 1c8m 4:,2: [83044]
   complexed with w11, zn

Details for d1c8m.1

PDB Entry: 1c8m, 2.8 Å

PDB Description: refined crystal structure of human rhinovirus 16 complexed with vp63843 (pleconaril), an anti-picornaviral drug currently in clinical trials

PDB Compounds: (2:) human rhinovirus 16 coat protein, (4:) human rhinovirus 16 coat protein

SCOPe Domain Sequences for d1c8m.1:

Sequence, based on SEQRES records:

>g1c8m.1 b.121.4.1 (4:,2:) Rhinovirus coat proteins {Human rhinovirus 16, (HRV-16) [TaxId: 31708]}
gaqvsrqnvgthstqnmvsngssinyfninyfkdaassgasrldXsdriiqitrgdstit
sqdvanavvgygvwphyltpqdataidkptqpdtssnrfytldskmwnstskgwwwklpd
alkdmgifgenmfyhflgrsgytvhvqcnaskfhqgtllvvmipehqlatvnkgnvnagy
kythpgeagrevgtqvenekqpsddnwlnfdgtllgnllifphqfinlrsnnsatlivpy
vnavpmdsmvrhnnwslviipvcqlqsnnisnivpitvsispmcaefsgaraktvvq

Sequence, based on observed residues (ATOM records):

>g1c8m.1 b.121.4.1 (4:,2:) Rhinovirus coat proteins {Human rhinovirus 16, (HRV-16) [TaxId: 31708]}
gaqvsrqsinyfninyfkdaassgasrldXsdriiqitrgdstitsqdvanavvgygvwp
hyltpqdataidkptqpdtssnrfytldskmwnstskgwwwklpdalkdmgifgenmfyh
flgrsgytvhvqcnaskfhqgtllvvmipehqlatvnkgnvnagykythpgeagrevgtq
venekqpsddnwlnfdgtllgnllifphqfinlrsnnsatlivpyvnavpmdsmvrhnnw
slviipvcqlqsnnisnivpitvsispmcaefsgaraktvvq

Timeline for d1c8m.1:

• d1c8m.1 first appeared in SCOP 1.65
  
• d1c8m.1 appears in SCOPe 2.04
  
• d1c8m.1 appears in SCOPe 2.06
  
• d1c8m.1 appears in the current release, SCOPe 2.08