Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
Protein Bovine enterovirus coat proteins [49676] (1 species) |
Species Bovine enterovirus, VG-5-27 [TaxId:12064] [49677] (3 PDB entries) |
Domain d1bev.1: 1bev 4:,2: [83040] complexed with myr, so4 |
PDB Entry: 1bev (more details), 3 Å
SCOPe Domain Sequences for d1bev.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1bev.1 b.121.4.1 (4:,2:) Bovine enterovirus coat proteins {Bovine enterovirus, VG-5-27 [TaxId: 12064]} stinynninyyshaasaaqnkqdftqdpskftqpiadvikXeacgysdrvaqltlgnsti ttqeaanicvaygcwpaklsdtdatsvdkptepgvsadrfytlrskpwqadskgwywklp dalnntgmfgqnaqfhylyrggwavhvqcnatkfhqgtllvlaipehqiatqeqpafdrt mpgseggtfqepfwledgtslgnsliyphqwinlrtnnsatlilpyvnaipmdsairhsn wtlaiipvaplkyaaettplvpitvtiapmeteynglrraiasnq
Timeline for d1bev.1:
View in 3D Domains from other chains: (mouse over for more information) d1bev1_, d1bev1_, d1bev3_, d1bev3_ |