Lineage for d1914_2 (1914 2001-2097)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328307Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
    (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta
  4. 328308Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (1 family) (S)
  5. 328309Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (2 proteins)
  6. 328310Protein Signal recognition particle 14KDa protein, SRP14 [88848] (2 species)
  7. 328315Species Mouse (Mus musculus) [TaxId:10090] [88850] (1 PDB entry)
  8. 328316Domain d1914_2: 1914 2001-2097 [83029]
    Other proteins in same PDB: d1914_1
    single polypeptide chain construct with SRP9 and linker, res. 3001-3008
    complexed with bme, po4

Details for d1914_2

PDB Entry: 1914 (more details), 2.53 Å

PDB Description: signal recognition particle alu rna binding heterodimer, srp9/14

SCOP Domain Sequences for d1914_2:

Sequence, based on SEQRES records: (download)

>d1914_2 d.49.1.1 (2001-2097) Signal recognition particle 14KDa protein, SRP14 {Mouse (Mus musculus)}
mvlleseqflteltrlfqkcrssgsvfitlkkydgrtkpiprkssveglepaenkcllra
tdgkrkistvvsskevnkfqmaysnllranmdglkkr

Sequence, based on observed residues (ATOM records): (download)

>d1914_2 d.49.1.1 (2001-2097) Signal recognition particle 14KDa protein, SRP14 {Mouse (Mus musculus)}
mvlleseqflteltrlfqkcrssgsvfitlkkydeglepaenkcllratdgkrkistvvs
skevnkfqmaysnllranmdglkkr

SCOP Domain Coordinates for d1914_2:

Click to download the PDB-style file with coordinates for d1914_2.
(The format of our PDB-style files is described here.)

Timeline for d1914_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1914_1