Lineage for d1914_1 (1914 4004-4081)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328307Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
    (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta
  4. 328308Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (1 family) (S)
  5. 328309Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (2 proteins)
  6. 328317Protein Signal recognition particle 9KDa protein, SRP9 [88845] (2 species)
  7. 328322Species Mouse (Mus musculus) [TaxId:10090] [88847] (1 PDB entry)
  8. 328323Domain d1914_1: 1914 4004-4081 [83028]
    Other proteins in same PDB: d1914_2
    single polypeptide chain construct with a SRP14 domain and linker, res. 3001-3008
    complexed with bme, po4

Details for d1914_1

PDB Entry: 1914 (more details), 2.53 Å

PDB Description: signal recognition particle alu rna binding heterodimer, srp9/14

SCOP Domain Sequences for d1914_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1914_1 d.49.1.1 (4004-4081) Signal recognition particle 9KDa protein, SRP9 {Mouse (Mus musculus)}
fqtweefsraaeklyladpmkvrvvlkyrhvdgnlcikvtddlvclvyrtdqaqdvkkie
kfhsqlmrlmvakesrnv

SCOP Domain Coordinates for d1914_1:

Click to download the PDB-style file with coordinates for d1914_1.
(The format of our PDB-style files is described here.)

Timeline for d1914_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1914_2