Lineage for d1914a1 (1914 A:4004-4081)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946817Fold d.49: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54761] (1 superfamily)
    (beta)-alpha-beta(3)-alpha; 2 layers, alpha/beta
  4. 2946818Superfamily d.49.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54762] (2 families) (S)
  5. 2946819Family d.49.1.1: Signal recognition particle alu RNA binding heterodimer, SRP9/14 [54763] (2 proteins)
  6. 2946827Protein Signal recognition particle 9KDa protein, SRP9 [88845] (2 species)
  7. 2946832Species Mouse (Mus musculus) [TaxId:10090] [88847] (1 PDB entry)
  8. 2946833Domain d1914a1: 1914 A:4004-4081 [83028]
    Other proteins in same PDB: d1914a2
    single polypeptide chain construct with a SRP14 domain and linker, res. 3001-3008
    complexed with bme, po4

Details for d1914a1

PDB Entry: 1914 (more details), 2.53 Å

PDB Description: signal recognition particle alu rna binding heterodimer, srp9/14
PDB Compounds: (A:) signal recognition particle 9/14 fusion protein

SCOPe Domain Sequences for d1914a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1914a1 d.49.1.1 (A:4004-4081) Signal recognition particle 9KDa protein, SRP9 {Mouse (Mus musculus) [TaxId: 10090]}
fqtweefsraaeklyladpmkvrvvlkyrhvdgnlcikvtddlvclvyrtdqaqdvkkie
kfhsqlmrlmvakesrnv

SCOPe Domain Coordinates for d1914a1:

Click to download the PDB-style file with coordinates for d1914a1.
(The format of our PDB-style files is described here.)

Timeline for d1914a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1914a2