Lineage for d4atja_ (4atj A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358328Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 358329Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 358330Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 358468Protein Plant peroxidase [48125] (6 species)
  7. 358471Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (28 PDB entries)
  8. 358505Domain d4atja_: 4atj A: [81266]

Details for d4atja_

PDB Entry: 4atj (more details), 2.5 Å

PDB Description: distal heme pocket mutant (h42e) of recombinant horseradish peroxidase in complex with benzhydroxamic acid

SCOP Domain Sequences for d4atja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4atja_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana)}
mqltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfedcfvngcdasilldntt
sfrtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrv
plgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrf
imdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnlee
qkgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirl
ncrvvnsns

SCOP Domain Coordinates for d4atja_:

Click to download the PDB-style file with coordinates for d4atja_.
(The format of our PDB-style files is described here.)

Timeline for d4atja_: