| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
| Protein Stromelysin-1 (MMP-3) [55536] (1 species) |
| Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries) |
| Domain d1qicc_: 1qic C: [81264] complexed with ca, zn |
PDB Entry: 1qic (more details), 2 Å
SCOPe Domain Sequences for d1qicc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qicc_ d.92.1.11 (C:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
ipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfav
rehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighslg
lfhsantealmyplyhsltdltrfrlsqddingiqslygpp
Timeline for d1qicc_: