Lineage for d1oaia_ (1oai A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309372Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2309396Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2309564Family a.5.2.3: TAP-C domain-like [68973] (2 proteins)
  6. 2309565Protein FG-binding, C-terminal domain of TAP [68974] (1 species)
  7. 2309566Species Human (Homo sapiens) [TaxId:9606] [68975] (2 PDB entries)
  8. 2309567Domain d1oaia_: 1oai A: [81255]
    complexed with FxFG nucleoporin peptide

Details for d1oaia_

PDB Entry: 1oai (more details), 1 Å

PDB Description: complex between tap uba domain and fxfg nucleoporin peptide
PDB Compounds: (A:) nuclear RNA export factor

SCOPe Domain Sequences for d1oaia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]}
ptlspeqqemlqafstqsgmnlewsqkclqdnnwdytrsaqafthlkakgeipevafmk

SCOPe Domain Coordinates for d1oaia_:

Click to download the PDB-style file with coordinates for d1oaia_.
(The format of our PDB-style files is described here.)

Timeline for d1oaia_: