| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.2: UBA-like [46934] (5 families) ![]() |
| Family a.5.2.3: TAP-C domain-like [68973] (2 proteins) |
| Protein FG-binding, C-terminal domain of TAP [68974] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [68975] (2 PDB entries) |
| Domain d1oaia_: 1oai A: [81255] complexed with FxFG nucleoporin peptide |
PDB Entry: 1oai (more details), 1 Å
SCOPe Domain Sequences for d1oaia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]}
ptlspeqqemlqafstqsgmnlewsqkclqdnnwdytrsaqafthlkakgeipevafmk
Timeline for d1oaia_: