Lineage for d1oadb_ (1oad B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088839Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2088890Family c.1.15.3: Xylose isomerase [51665] (2 protein domains)
  6. 2088891Protein D-xylose isomerase [51666] (13 species)
  7. 2089019Species Streptomyces rubiginosus [TaxId:1929] [51670] (51 PDB entries)
  8. 2089033Domain d1oadb_: 1oad B: [81254]
    complexed with mg, mn, mpd, mqd, mrd, trs

Details for d1oadb_

PDB Entry: 1oad (more details), 1.5 Å

PDB Description: glucose isomerase from streptomyces rubiginosus in p21212 crystal form
PDB Compounds: (B:) xylose isomerase

SCOPe Domain Sequences for d1oadb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oadb_ c.1.15.3 (B:) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
nyqptpedrftfglwtvgwegrdpfgdatrraldpvesvrrlaelgahgvtfhdddlipf
gssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrktir
nidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
fhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvwa
saagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeefd
vdaaaargmaferldqlamdhllgar

SCOPe Domain Coordinates for d1oadb_:

Click to download the PDB-style file with coordinates for d1oadb_.
(The format of our PDB-style files is described here.)

Timeline for d1oadb_: