Class b: All beta proteins [48724] (144 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (3 families) duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins) contains metal-binding preSET and postSET domains |
Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82206] (6 PDB entries) |
Domain d1o9sb2: 1o9s B:194-366 [81252] Other proteins in same PDB: d1o9sa1, d1o9sb1 |
PDB Entry: 1o9s (more details), 1.75 Å
SCOP Domain Sequences for d1o9sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9sb2 b.85.7.1 (B:194-366) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens)} dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf gpikcirtlraveadeeltvaygydhsppgksgpeapewyqvelkafqatqqk
Timeline for d1o9sb2: