Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins) catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest |
Protein Succinate:CoA transferase, C-terminal domain [82466] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [82467] (8 PDB entries) |
Domain d1o9ld2: 1o9l D:300-520 [81248] Other proteins in same PDB: d1o9la1, d1o9lb1, d1o9lc1, d1o9ld1 complexed with emc, emt |
PDB Entry: 1o9l (more details), 2.4 Å
SCOPe Domain Sequences for d1o9ld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9ld2 c.124.1.3 (D:300-520) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} nvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnev dadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgkl vkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvd rkkgltlielwegltvddikkstgcdfavspklipmqqvtt
Timeline for d1o9ld2: