SCOPe 2.08: Domain d1o9ld2: 1o9l D:300-520

Lineage for d1o9ld2 (1o9l D:300-520)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins)
   catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest

6. Protein Succinate:CoA transferase, C-terminal domain [82466] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [82467] (8 PDB entries)

8. Domain d1o9ld2: 1o9l D:300-520 [81248]
   Other proteins in same PDB: d1o9la1, d1o9lb1, d1o9lc1, d1o9ld1
   complexed with emc, emt

Details for d1o9ld2

PDB Entry: 1o9l, 2.4 Å

PDB Description: succinate:coenzyme-a transferase (pig heart)

PDB Compounds: (D:) succinyl-coa:3-ketoacid-coenzyme a transferase

SCOPe Domain Sequences for d1o9ld2:

Sequence; same for both SEQRES and ATOM records:

>d1o9ld2 c.124.1.3 (D:300-520) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
nvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnev
dadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgkl
vkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvd
rkkgltlielwegltvddikkstgcdfavspklipmqqvtt

Timeline for d1o9ld2:

• d1o9ld2 first appeared in SCOP 1.63
  
• d1o9ld2 appears in SCOPe 2.07