Lineage for d1o9lb2 (1o9l B:300-520)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404937Fold c.124: NagB/RpiA/CoA transferase [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 404938Superfamily c.124.1: NagB/RpiA/CoA transferase [100950] (4 families) (S)
  5. 404993Family c.124.1.3: CoA transferase beta subunit-like [74657] (2 proteins)
    catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest
  6. 404998Protein Succinate:CoA transferase, C-terminal domain [82466] (1 species)
  7. 404999Species Pig (Sus scrofa) [TaxId:9823] [82467] (5 PDB entries)
  8. 405007Domain d1o9lb2: 1o9l B:300-520 [81244]
    Other proteins in same PDB: d1o9la1, d1o9lb1, d1o9lc1, d1o9ld1

Details for d1o9lb2

PDB Entry: 1o9l (more details), 2.4 Å

PDB Description: succinate:coenzyme-a transferase (pig heart)

SCOP Domain Sequences for d1o9lb2:

Sequence, based on SEQRES records: (download)

>d1o9lb2 c.124.1.3 (B:300-520) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa)}
nvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnev
dadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgkl
vkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvd
rkkgltlielwegltvddikkstgcdfavspklipmqqvtt

Sequence, based on observed residues (ATOM records): (download)

>d1o9lb2 c.124.1.3 (B:300-520) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa)}
nvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnev
dadlinagketvtvlpgasyfssdesfamirgghvnltmlgvkgmggamdlvssaktkvv
vtcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvtt

SCOP Domain Coordinates for d1o9lb2:

Click to download the PDB-style file with coordinates for d1o9lb2.
(The format of our PDB-style files is described here.)

Timeline for d1o9lb2: