Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins) parallel beta-sheet of 7 strands, order 4321567 |
Protein Succinate:CoA transferase, N-terminal domain [82464] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [82465] (8 PDB entries) |
Domain d1o9lb1: 1o9l B:40-286 [81243] Other proteins in same PDB: d1o9la2, d1o9lb2, d1o9lc2, d1o9ld2 complexed with emc, emt |
PDB Entry: 1o9l (more details), 2.4 Å
SCOPe Domain Sequences for d1o9lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9lb1 c.124.1.2 (B:40-286) Succinate:CoA transferase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} tkfytdaveavkdipngatvlvggfglcgipenligallktgvkeltavsnnagvdnfgl glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri erlsvrk
Timeline for d1o9lb1: