SCOP 1.67: Domain d1o9bb2: 1o9b B:7-106

Lineage for d1o9bb2 (1o9b B:7-106)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)

6. Protein Putative shikimate dehydrogenase YdiB [82337] (1 species)

7. Species Escherichia coli [TaxId:562] [82338] (3 PDB entries)

8. Domain d1o9bb2: 1o9b B:7-106 [81240]
   Other proteins in same PDB: d1o9ba1, d1o9bb1
   complexed with mse, nad, po4

Details for d1o9bb2

PDB Entry: 1o9b, 2.5 Å

PDB Description: quinate/shikimate dehydrogenase ydib complexed with nadh

SCOP Domain Sequences for d1o9bb2:

Sequence; same for both SEQRES and ATOM records:

>d1o9bb2 c.58.1.5 (B:7-106) Putative shikimate dehydrogenase YdiB {Escherichia coli}
yeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalkmrgtgv
smpnkqlaceyvdeltpaaklvgaintivnddgylrgynt

Timeline for d1o9bb2:

• d1o9bb2 first appeared in SCOP 1.63
  
• d1o9bb2 appears in SCOP 1.65
  
• d1o9bb2 appears in SCOP 1.69
  
• d1o9bb2 appears in the current release, SCOPe 2.08