Lineage for d1o9bb2 (1o9b B:7-106)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 246933Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 246934Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 247087Family c.58.1.5: Putative shikimate dehydrogenase YdiB [82336] (1 protein)
  6. 247088Protein Putative shikimate dehydrogenase YdiB [82337] (1 species)
  7. 247089Species Escherichia coli [TaxId:562] [82338] (2 PDB entries)
  8. 247093Domain d1o9bb2: 1o9b B:7-106 [81240]
    Other proteins in same PDB: d1o9ba1, d1o9bb1
    complexed with mse, nad, po4

Details for d1o9bb2

PDB Entry: 1o9b (more details), 2.5 Å

PDB Description: quinate/shikimate dehydrogenase ydib complexed with nadh

SCOP Domain Sequences for d1o9bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9bb2 c.58.1.5 (B:7-106) Putative shikimate dehydrogenase YdiB {Escherichia coli}
yeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalkmrgtgv
smpnkqlaceyvdeltpaaklvgaintivnddgylrgynt

SCOP Domain Coordinates for d1o9bb2:

Click to download the PDB-style file with coordinates for d1o9bb2.
(The format of our PDB-style files is described here.)

Timeline for d1o9bb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o9bb1