SCOP 1.63: Domain d1o9bb1: 1o9b B:107-287

Lineage for d1o9bb1 (1o9b B:107-287)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (8 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Putative shikimate dehydrogenase YdiB [82305] (1 species)

7. Species Escherichia coli [TaxId:562] [82306] (2 PDB entries)

8. Domain d1o9bb1: 1o9b B:107-287 [81239]
   Other proteins in same PDB: d1o9ba2, d1o9bb2
   complexed with mse, nad, po4

Details for d1o9bb1

PDB Entry: 1o9b, 2.5 Å

PDB Description: quinate/shikimate dehydrogenase ydib complexed with nadh

SCOP Domain Sequences for d1o9bb1:

Sequence; same for both SEQRES and ATOM records:

>d1o9bb1 c.2.1.7 (B:107-287) Putative shikimate dehydrogenase YdiB {Escherichia coli}
dgtghiraikesgfdikgktmvllgaggastaigaqgaieglkeiklfnrrdeffdkala
faqrvnentdcvvtvtdladqqafaealasadiltngtkvgmkpleneslvndisllhpg
llvtecvynphmtkllqqaqqagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgf
g

Timeline for d1o9bb1:

• d1o9bb1 is new in SCOP 1.63
  
• d1o9bb1 appears in SCOP 1.65
  
• d1o9bb1 appears in the current release, SCOPe 2.08