SCOPe 2.06: Domain d1o9ba2: 1o9b A:7-106

Lineage for d1o9ba2 (1o9b A:7-106)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)

6. Protein Putative shikimate dehydrogenase YdiB [82337] (1 species)

7. Species Escherichia coli [TaxId:562] [82338] (3 PDB entries)

8. Domain d1o9ba2: 1o9b A:7-106 [81238]
   Other proteins in same PDB: d1o9ba1, d1o9bb1
   complexed with nai, po4

Details for d1o9ba2

PDB Entry: 1o9b, 2.5 Å

PDB Description: quinate/shikimate dehydrogenase ydib complexed with nadh

PDB Compounds: (A:) hypothetical shikimate 5-dehydrogenase-like protein ydib

SCOPe Domain Sequences for d1o9ba2:

Sequence; same for both SEQRES and ATOM records:

>d1o9ba2 c.58.1.5 (A:7-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]}
yeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalkmrgtgv
smpnkqlaceyvdeltpaaklvgaintivnddgylrgynt

Timeline for d1o9ba2:

• d1o9ba2 first appeared in SCOP 1.63
  
• d1o9ba2 appears in SCOPe 2.05
  
• d1o9ba2 appears in SCOPe 2.07
  
• d1o9ba2 appears in the current release, SCOPe 2.08