Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins) |
Protein Putative shikimate dehydrogenase YdiB [82337] (1 species) |
Species Escherichia coli [TaxId:562] [82338] (3 PDB entries) |
Domain d1o9ba2: 1o9b A:7-106 [81238] Other proteins in same PDB: d1o9ba1, d1o9bb1 complexed with nai, po4 |
PDB Entry: 1o9b (more details), 2.5 Å
SCOPe Domain Sequences for d1o9ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9ba2 c.58.1.5 (A:7-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} yeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalkmrgtgv smpnkqlaceyvdeltpaaklvgaintivnddgylrgynt
Timeline for d1o9ba2: