Lineage for d1o96q_ (1o96 Q:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392101Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 392401Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 392495Family c.26.2.3: ETFP subunits [52432] (2 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 392512Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
    binds AMP
  7. 392515Species Methylophilus methylotrophus [TaxId:17] [82363] (4 PDB entries)
  8. 392522Domain d1o96q_: 1o96 Q: [81229]
    Other proteins in same PDB: d1o96b1, d1o96b2, d1o96d1, d1o96d2, d1o96f1, d1o96f2, d1o96z1, d1o96z2
    complexed with amp, fad

Details for d1o96q_

PDB Entry: 1o96 (more details), 3.1 Å

PDB Description: structure of electron transferring flavoprotein for methylophilus methylotrophus.

SCOP Domain Sequences for d1o96q_:

Sequence, based on SEQRES records: (download)

>d1o96q_ c.26.2.3 (Q:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipekgra
tmiegtiseqaakiiqiinef

Sequence, based on observed residues (ATOM records): (download)

>d1o96q_ c.26.2.3 (Q:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus}
mkilvavkqtaaleedfeirdgmdvdedfmmydlnewddfsleeamkikessdtdvevvv
vsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagvq
ssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavlt
iqlginkppieevsladiglsandvgaaqsmsrvrrmyipekgratmiegtiseqaakii
qiinef

SCOP Domain Coordinates for d1o96q_:

Click to download the PDB-style file with coordinates for d1o96q_.
(The format of our PDB-style files is described here.)

Timeline for d1o96q_: