| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.3: ETFP subunits [52432] (3 protein domains) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
| Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species) contains an additional FAD-binding domain of DHS-like fold |
| Species Methylophilus methylotrophus [TaxId:17] [82362] (8 PDB entries) |
| Domain d1o96d1: 1o96 D:1-191 [81224] Other proteins in same PDB: d1o96a_, d1o96b2, d1o96c_, d1o96d2, d1o96e_, d1o96f2, d1o96q_, d1o96z2 complexed with amp, fad |
| PDB Entry: 1o96 (more details) PDB Description: structure of electron transferring flavoprotein for methylophilus methylotrophus.
PDB Compounds: (D:) electron transferring flavoprotein alpha-subunitSCOP Domain Sequences for d1o96d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o96d1 c.26.2.3 (D:1-191) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyvev
SCOP Domain Coordinates for d1o96d1:
Click to download the PDB-style file with coordinates for d1o96d1. (The format of our PDB-style files is described here.)
Timeline for d1o96d1:
d1o96d1 appears in SCOP 1.75A | d1o96d1 (click for larger image) d1o96d1 in context of chain Domains from same chain: d1o96d2 d1o96d1 in context of PDB Domains from other chains: d1o96a_, d1o96b1, d1o96b2, d1o96c_, d1o96e_, d1o96f1, d1o96f2, d1o96q_, d1o96z1, d1o96z2 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |