Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1o96b2 (1o96 B:196-318)

  1. Root: SCOP 1.75B
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
    lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain
  6. Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species)
  7. Species Methylophilus methylotrophus [TaxId:17] [82379] (6 PDB entries)
  8. Domain d1o96b2: 1o96 B:196-318 [81222]
    Other proteins in same PDB: d1o96a_, d1o96b1, d1o96c_, d1o96d1, d1o96e_, d1o96f1, d1o96q_, d1o96z1
    complexed with amp, fad

Details for d1o96b2

PDB Entry: 1o96 (more details)
PDB Description: structure of electron transferring flavoprotein for methylophilus methylotrophus.
PDB Compounds: (B:) electron transferring flavoprotein alpha-subunit

SCOP Domain Sequences for d1o96b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o96b2 c.31.1.2 (B:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]}
didittvdfimsigrgigeetnveqfreladeagatlccsrpiadagwlpksrqvgqsgk
vvgscklyvamgisgsiqhmagmkhvptiiavntdpgasiftiakygivadifdieeelk
aql

SCOP Domain Coordinates for d1o96b2:

Click to download the PDB-style file with coordinates for d1o96b2.
(The format of our PDB-style files is described here.)

Timeline for d1o96b2:

d1o96b2 appears in SCOP 1.75A


d1o96b2
(click for larger image)


d1o96b2 in context of chain
Domains from same chain:
d1o96b1


d1o96b2 in context of PDB
Domains from other chains:
d1o96a_, d1o96c_, d1o96d1, d1o96d2, d1o96e_, d1o96f1, d1o96f2, d1o96q_, d1o96z1, d1o96z2

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu