Lineage for d1o95f_ (1o95 F:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242042Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 242253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    the first three families are more closely related to each other as the last two families are
  5. 242318Family c.26.2.3: ETFP subunits [52432] (2 proteins)
    alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet
  6. 242319Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
    contains an additional FAD-binding fomain of DHS-like fold
  7. 242322Species Methylophilus methylotrophus [TaxId:17] [82362] (4 PDB entries)
  8. 242331Domain d1o95f_: 1o95 F: [81219]
    Other proteins in same PDB: d1o95a1, d1o95a2, d1o95a3, d1o95b1, d1o95b2, d1o95b3, d1o95c_, d1o95e_
    complexed with adp, amp, fmn, fs4

Details for d1o95f_

PDB Entry: 1o95 (more details), 3.7 Å

PDB Description: Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein

SCOP Domain Sequences for d1o95f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o95f_ c.26.2.3 (F:) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyv

SCOP Domain Coordinates for d1o95f_:

Click to download the PDB-style file with coordinates for d1o95f_.
(The format of our PDB-style files is described here.)

Timeline for d1o95f_: