Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.3: ETFP subunits [52432] (2 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species) binds AMP |
Species Methylophilus methylotrophus [TaxId:17] [82363] (4 PDB entries) |
Domain d1o95e_: 1o95 E: [81218] Other proteins in same PDB: d1o95a1, d1o95a2, d1o95a3, d1o95b1, d1o95b2, d1o95b3, d1o95d_, d1o95f_ complexed with adp, amp, fmn, fs4 |
PDB Entry: 1o95 (more details), 3.7 Å
SCOP Domain Sequences for d1o95e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o95e_ c.26.2.3 (E:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus} mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyipe
Timeline for d1o95e_: