| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.3: ETFP subunits [52432] (3 protein domains) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
| Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species) binds AMP |
| Species Methylophilus methylotrophus [TaxId:17] [82363] (8 PDB entries) |
| Domain d1o95c_: 1o95 C: [81216] Other proteins in same PDB: d1o95a1, d1o95a2, d1o95a3, d1o95b1, d1o95b2, d1o95b3, d1o95d_, d1o95f_ complexed with adp, amp, fmn, sf4 |
| PDB Entry: 1o95 (more details) PDB Description: ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein
PDB Compounds: (C:) Electron transfer flavoprotein beta-subunitSCOP Domain Sequences for d1o95c_:
Sequence, based on SEQRES records: (download)
>d1o95c_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeiredgmdvdedfmmydlnewddfsleeamkikessdtdvevv
vvsvgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagv
qssdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavl
tiqlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyip
Sequence, based on observed residues (ATOM records): (download)
>d1o95c_ c.26.2.3 (C:) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]}
mkilvavkqtaaleedfeirdgmdvdedfmmydlnewddfsleeamkikessddvevvvv
svgpdrvdeslrkclakgadravrvwddaaegsdaivvgriltevikkeapdmvfagvqs
sdqayastgisvasylnwphaavvadlqykpgdnkavirreleggmlqeveincpavlti
qlginkpryaslrgikqaatkpieevsladiglsandvgaaqsmsrvrrmyip
SCOP Domain Coordinates for d1o95c_:
Click to download the PDB-style file with coordinates for d1o95c_. (The format of our PDB-style files is described here.)
Timeline for d1o95c_:
d1o95c_ appears in SCOP 1.75A | d1o95c_ (click for larger image) d1o95c_ in context of chain d1o95c_ in context of PDB Domains from other chains: d1o95a1, d1o95a2, d1o95a3, d1o95b1, d1o95b2, d1o95b3, d1o95d_, d1o95e_, d1o95f_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |